PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000210851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 290aa    MW: 31952.6 Da    PI: 5.9488
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000210851genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.7e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed++l  ++k +G g W++ +++ g++R++k+c++rw++yl
    MDP0000210851 14 RGAWTALEDKILSSYIKAHGEGKWRSLPKRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding491.4e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
    MDP0000210851  67 RGNISGDEEELIVRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                      6777889***************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.984961IPR017930Myb domain
SuperFamilySSF466896.64E-2712108IPR009057Homeodomain-like
SMARTSM007175.5E-121363IPR001005SANT/Myb domain
PfamPF002498.5E-141461IPR001005SANT/Myb domain
CDDcd001679.29E-91661No hitNo description
PROSITE profilePS5129423.44962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-2365115IPR009057Homeodomain-like
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002492.0E-1367111IPR001005SANT/Myb domain
CDDcd001671.06E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTAL EDKILSSYIK AHGEGKWRSL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SGDEEELIVR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT TLGKKSKVDS  120
FSGSSKETSL NPCKSIAKKK DVESKTSTAA AQPLVIRTKA TRLTKILVPQ NIPSDENYTA  180
AAANPLELQT QSAEKGGSTE EFPRTNAGDC SNILKNFGCD DDDIDAKGDQ YCNEFQLLNS  240
IPLDEAXIND GCWTGGNGCD LEDYGASLDL DSLAFLLDSE EWPSQENVVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241211525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.304040.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2679000.0DQ267900.1 Malus x domestica cultivar Royal Gala MYB9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280749.10.0uncharacterized protein LOC103440900
TrEMBLQ0QMQ80.0Q0QMQ8_MALDO; MYB9
STRINGVIT_04s0008g01800.t018e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-63MYB family protein